PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna19934.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 311aa    MW: 35224.5 Da    PI: 6.3139
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna19934.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-151764148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg W++eEde+l + ++  G g+W++I++  g+ R++k+c++rw +yl
  mrna19934.1-v1.0-hybrid 17 RGLWSPEEDEKLMNHIHHSGHGSWSSIPKIAGLERCGKSCRLRWINYL 64
                             788*******************************************97 PP

2Myb_DNA-binding51.22.9e-1670113146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+++++E+ +++d+++ lG++ W+ Ia+ m+ gRt++++k++w++
  mrna19934.1-v1.0-hybrid  70 RGSFSEQEERIIIDVHRVLGNR-WAQIAKQMP-GRTDNEVKNFWNS 113
                              899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-25967IPR009057Homeodomain-like
PROSITE profilePS5129416.731264IPR017930Myb domain
SuperFamilySSF466897.35E-2914111IPR009057Homeodomain-like
SMARTSM007171.6E-111666IPR001005SANT/Myb domain
PfamPF002492.6E-141764IPR001005SANT/Myb domain
CDDcd001671.51E-92064No hitNo description
PROSITE profilePS5129425.73765119IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-2568120IPR009057Homeodomain-like
SMARTSM007174.2E-1569117IPR001005SANT/Myb domain
PfamPF002491.2E-1470113IPR001005SANT/Myb domain
CDDcd001671.08E-1072112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MSIDMVHNCC SKQKVKRGLW SPEEDEKLMN HIHHSGHGSW SSIPKIAGLE RCGKSCRLRW  60
INYLRPDLKR GSFSEQEERI IIDVHRVLGN RWAQIAKQMP GRTDNEVKNF WNSCIKKKLI  120
SQGLDPNTHN RIIPAASDNS KSNHDSSSLD ESSSSTLPTT YLFPNPNMAW TDLFQDQYPR  180
GSLPSVENSE IPIIPSFSHH YYPSELDIII ENCKKWGTGG SSGSDTTAEH TKMECLSMKP  240
EPVDESCEVQ TEKDSCNTVL NYNGRQTSMD ASSFGSCNLL DFDFVESTLV PCEMDYHLRP  300
IMDQVAWHRN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-31171197108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293863.10.0PREDICTED: transcription factor MYB46-like
TrEMBLM5WLA01e-101M5WLA0_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s12240.16e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34663267
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.15e-68myb domain protein 67